HPA002656

IFIH1 antibody from Sigma-Aldrich
Hlcd, IDDM19, MDA-5, MDA5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002656
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002656, RRID:AB_1079344
Product name
Anti-IFIH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002656
Antibody type
Polyclonal
Antigen
Interferon-induced helicase C domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGD
DEYCDGDEDEDDLKKPLKLDETDRFLMTLFFENNK
MLKRLAENPEYENEKLTKLRNTIMEQYTRTEESAR
GIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLI
GAGHSSEFKP
Storage
-20C
Provider Type Product Number
- No reagents -