HPA001482

IL1RN antibody from Atlas Antibodies
ICIL-1RA, IL-1RN, IL1F3, IL1RA, IRAP, MGC10430
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001482
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001482, RRID:AB_1078437
Product name
Anti-IL1RN
Provider product page
Atlas Antibodies - HPA001482
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLV
AGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMC
LSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFI
RSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNM
PDEGVMVTKF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -