HPA001482

IL1RN antibody from Sigma-Aldrich
ICIL-1RA, IL-1RN, IL1F3, IL1RA, IRAP, MGC10430
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001482
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001482, RRID:AB_1078437
Product name
Anti-IL1RN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001482
Antibody type
Polyclonal
Antigen
Interleukin-1 receptor antagonist protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLV
AGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMC
LSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFI
RSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNM
PDEGVMVTKF
Storage
-20C
Provider Type Product Number
- No reagents -