H00009361-M01

LONP1 antibody from Abnova Corporation
hLON, LonHS, PIM1, PRSS15
No application information provided.

Antibody data

Product number
H00009361-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009361-M01, RRID:AB_1137395
Product name
PRSS15 monoclonal antibody (M01), clone 3B2
Provider product page
Abnova Corporation - H00009361-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PRSS15.
Antigen sequence
YVAQEKLAIAERYLVPQARALCGLDESKAKLSSDV
LTLLIKQYCRESGVRNLQKQVEKVLRKSAYKIVSG
EAESVEVTPENLQDFVGKPVFTVERMYDVTP
Isotype
IgG
Antibody clone number
3B2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -