HPA002192

LONP1 antibody from Sigma-Aldrich
hLON, LonHS, PIM1, PRSS15
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002192
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002192, RRID:AB_1079695
Product name
Anti-LONP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002192
Antibody type
Polyclonal
Antigen
Lon protease homolog, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAI
EEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHS
SEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVL
EEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFY
GP
Storage
-20C
Provider Type Product Number
- No reagents -