Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004077-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004077-A01, RRID:AB_714781
- Product name
- NBR1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant NBR1.
- Antigen sequence
EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVK
VSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMA
VKQGNQLQMQVHEGHHVVDEAPPPV- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references NBR1 enables autophagy-dependent focal adhesion turnover.
p62 and NDP52 proteins target intracytosolic Shigella and Listeria to different autophagy pathways.
Kenific CM, Stehbens SJ, Goldsmith J, Leidal AM, Faure N, Ye J, Wittmann T, Debnath J
The Journal of cell biology 2016 Feb 29;212(5):577-90
The Journal of cell biology 2016 Feb 29;212(5):577-90
p62 and NDP52 proteins target intracytosolic Shigella and Listeria to different autophagy pathways.
Mostowy S, Sancho-Shimizu V, Hamon MA, Simeone R, Brosch R, Johansen T, Cossart P
The Journal of biological chemistry 2011 Jul 29;286(30):26987-95
The Journal of biological chemistry 2011 Jul 29;286(30):26987-95
No comments: Submit comment
No validations: Submit validation data