Antibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004077-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004077-M01, RRID:AB_1016849
- Product name
- NBR1 monoclonal antibody (M01), clone 6B11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NBR1.
- Antigen sequence
EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVK
VSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMA
VKQGNQLQMQVHEGHHVVDEAPPPV- Isotype
- IgG
- Antibody clone number
- 6B11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Peroxin Pex14p is the key component for coordinated autophagic degradation of mammalian peroxisomes by direct binding to LC3-II.
Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo.
NBR1 acts as an autophagy receptor for peroxisomes.
Brain region- and age-dependent dysregulation of p62 and NBR1 in a mouse model of Huntington's disease.
Molecular determinants of selective clearance of protein inclusions by autophagy.
Nbr1 is a novel inhibitor of ligand-mediated receptor tyrosine kinase degradation.
Spred2 interaction with the late endosomal protein NBR1 down-regulates fibroblast growth factor receptor signaling.
Jiang L, Hara-Kuge S, Yamashita S, Fujiki Y
Genes to cells : devoted to molecular & cellular mechanisms 2015 Jan;20(1):36-49
Genes to cells : devoted to molecular & cellular mechanisms 2015 Jan;20(1):36-49
Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo.
Dowdle WE, Nyfeler B, Nagel J, Elling RA, Liu S, Triantafellow E, Menon S, Wang Z, Honda A, Pardee G, Cantwell J, Luu C, Cornella-Taracido I, Harrington E, Fekkes P, Lei H, Fang Q, Digan ME, Burdick D, Powers AF, Helliwell SB, D'Aquin S, Bastien J, Wang H, Wiederschain D, Kuerth J, Bergman P, Schwalb D, Thomas J, Ugwonali S, Harbinski F, Tallarico J, Wilson CJ, Myer VE, Porter JA, Bussiere DE, Finan PM, Labow MA, Mao X, Hamann LG, Manning BD, Valdez RA, Nicholson T, Schirle M, Knapp MS, Keaney EP, Murphy LO
Nature cell biology 2014 Nov;16(11):1069-79
Nature cell biology 2014 Nov;16(11):1069-79
NBR1 acts as an autophagy receptor for peroxisomes.
Deosaran E, Larsen KB, Hua R, Sargent G, Wang Y, Kim S, Lamark T, Jauregui M, Law K, Lippincott-Schwartz J, Brech A, Johansen T, Kim PK
Journal of cell science 2013 Feb 15;126(Pt 4):939-52
Journal of cell science 2013 Feb 15;126(Pt 4):939-52
Brain region- and age-dependent dysregulation of p62 and NBR1 in a mouse model of Huntington's disease.
Rué L, López-Soop G, Gelpi E, Martínez-Vicente M, Alberch J, Pérez-Navarro E
Neurobiology of disease 2013 Apr;52:219-28
Neurobiology of disease 2013 Apr;52:219-28
Molecular determinants of selective clearance of protein inclusions by autophagy.
Wong E, Bejarano E, Rakshit M, Lee K, Hanson HH, Zaarur N, Phillips GR, Sherman MY, Cuervo AM
Nature communications 2012;3:1240
Nature communications 2012;3:1240
Nbr1 is a novel inhibitor of ligand-mediated receptor tyrosine kinase degradation.
Mardakheh FK, Auciello G, Dafforn TR, Rappoport JZ, Heath JK
Molecular and cellular biology 2010 Dec;30(24):5672-85
Molecular and cellular biology 2010 Dec;30(24):5672-85
Spred2 interaction with the late endosomal protein NBR1 down-regulates fibroblast growth factor receptor signaling.
Mardakheh FK, Yekezare M, Machesky LM, Heath JK
The Journal of cell biology 2009 Oct 19;187(2):265-77
The Journal of cell biology 2009 Oct 19;187(2):265-77
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NBR1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol