H00004077-M05A

NBR1 antibody from Abnova Corporation
1A1-3B, CA125, KIAA0049, M17S2

Antibody data

Product number
H00004077-M05A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004077-M05A, RRID:AB_1577594
Product name
NBR1 monoclonal antibody (M05A), clone 5C3
Provider product page
Abnova Corporation - H00004077-M05A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NBR1.
Antigen sequence
EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVK
VSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMA
VKQGNQLQMQVHEGHHVVDEAPPPV
Isotype
IgG
Antibody clone number
5C3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -