HPA000872

PSMC1 antibody from Sigma-Aldrich
p56, S4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000872
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000872, RRID:AB_1079705
Product name
Anti-PSMC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000872
Antibody type
Polyclonal
Antigen
26S protease regulatory subunit 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIM
ATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRI
FQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAIC
TEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGT
PE
Storage
-20C
Provider Type Product Number
- No reagents -