HPA017379

HLCS antibody from Sigma-Aldrich
HCS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017379
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017379, RRID:AB_1850768
Product name
Anti-HLCS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017379
Antibody type
Polyclonal
Antigen
Biotin--protein ligase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DLPYDYSSSLESVADETSPEREGRRVNLTGKAPNI
LLYVGSDSQEALGRFHEVRSVLADCVDIDSYILYH
LLEDSALRDPWTDNCLLLVIATRESIPEDLYQKFM
AYLSQGGKVLGLSSSFTFGGFQV
Storage
-20C
Provider Type Product Number
- No reagents -