ABIN404835

HIF1A antibody from antibodies-online
bHLHe78, HIF-1alpha, HIF1, MOP1, PASD8

Antibody data

Product number
ABIN404835
Provider
antibodies-online
Product name
anti-Hypoxia Inducible Factor 1, alpha Subunit Inhibitor (HIF1AN) (Middle Region) antibody
Provider product page
antibodies-online - ABIN404835
Antibody type
Polyclonal
Antigen
The immunogen for anti-HIF1AN antibody: synthetic peptide directed towards the middle region of human HIF1AN
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
TSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCI
LFPPD QFECLYPYPV
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -