Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404835 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Hypoxia Inducible Factor 1, alpha Subunit Inhibitor (HIF1AN) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HIF1AN antibody: synthetic peptide directed towards the middle region of human HIF1AN
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
TSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCI
LFPPD QFECLYPYPV- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Substrate requirements of the oxygen-sensing asparaginyl hydroxylase factor-inhibiting hypoxia-inducible factor.
Linke S, Stojkoski C, Kewley RJ, Booker GW, Whitelaw ML, Peet DJ
The Journal of biological chemistry 2004 Apr 2;279(14):14391-7
The Journal of biological chemistry 2004 Apr 2;279(14):14391-7
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting