Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405217 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Hypoxia Inducible Factor 1, alpha Subunit Inhibitor (HIF1AN) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HIF1AN antibody: synthetic peptide directed towards the middle region of human HIF1AN
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
GGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRN
IEKML GEALGNPQEV- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Polymorphisms in angiogenesis-related genes and prostate cancer.
Jacobs EJ, Hsing AW, Bain EB, Stevens VL, Wang Y, Chen J, Chanock SJ, Zheng SL, Xu J, Thun MJ, Calle EE, Rodriguez C
Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology 2008 Apr;17(4):972-7
Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology 2008 Apr;17(4):972-7
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting