HPA001275

HIF1A antibody from Atlas Antibodies
bHLHe78, HIF-1alpha, HIF1, MOP1, PASD8
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001275
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001275, RRID:AB_1079057
Product name
Anti-HIF1A
Provider product page
Atlas Antibodies - HPA001275
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KSHPRSPNVLSVALSQRTTVPEEELNPKILALQNA
QRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLS
WKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQS
MDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRA
LD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -