Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001275 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001275, RRID:AB_1079057
- Product name
- Anti-HIF1A
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KSHPRSPNVLSVALSQRTTVPEEELNPKILALQNA
QRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLS
WKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQS
MDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRA
LD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Putative role of HIF transcriptional activity in melanocytes and melanoma biology.
Interaction with ErbB4 promotes hypoxia-inducible factor-1α signaling.
Halting angiogenesis by non-viral somatic gene therapy alleviates psoriasis and murine psoriasiform skin lesions.
Carbonic anhydrase IX expression in prostate cancer
Zbytek B, Peacock DL, Seagroves TN, Slominski A
Dermato-endocrinology 2013 Apr 1;5(2):239-51
Dermato-endocrinology 2013 Apr 1;5(2):239-51
Interaction with ErbB4 promotes hypoxia-inducible factor-1α signaling.
Paatero I, Jokilammi A, Heikkinen PT, Iljin K, Kallioniemi OP, Jones FE, Jaakkola PM, Elenius K
The Journal of biological chemistry 2012 Mar 23;287(13):9659-9671
The Journal of biological chemistry 2012 Mar 23;287(13):9659-9671
Halting angiogenesis by non-viral somatic gene therapy alleviates psoriasis and murine psoriasiform skin lesions.
Zibert JR, Wallbrecht K, Schön M, Mir LM, Jacobsen GK, Trochon-Joseph V, Bouquet C, Villadsen LS, Cadossi R, Skov L, Schön MP
The Journal of clinical investigation 2011 Jan;121(1):410-21
The Journal of clinical investigation 2011 Jan;121(1):410-21
Carbonic anhydrase IX expression in prostate cancer
Smyth L, O'Hurley G, O'Grady A, Fitzpatrick J, Kay E, Watson R
Prostate Cancer and Prostatic Diseases 2009 December;13(2):178-181
Prostate Cancer and Prostatic Diseases 2009 December;13(2):178-181
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction center.
- Sample type
- HUMAN