HPA001275

HIF1A antibody from Sigma-Aldrich
bHLHe78, HIF-1alpha, HIF1, MOP1, PASD8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001275
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001275, RRID:AB_1079057
Product name
Anti-HIF1A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001275
Antibody type
Polyclonal
Antigen
Hypoxia-inducible factor 1 alpha recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KSHPRSPNVLSVALSQRTTVPEEELNPKILALQNA
QRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLS
WKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQS
MDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRA
LD
Storage
-20C
Provider Type Product Number
- No reagents -