Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405215 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Notch 1 (NOTCH1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NOTCH1 antibody: synthetic peptide directed towards the middle region of human NOTCH1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
EHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPP
TSMQS QIARIPEAFK- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Notch signaling mediates hypoxia-induced tumor cell migration and invasion.
Sahlgren C, Gustafsson MV, Jin S, Poellinger L, Lendahl U
Proceedings of the National Academy of Sciences of the United States of America 2008 Apr 29;105(17):6392-7
Proceedings of the National Academy of Sciences of the United States of America 2008 Apr 29;105(17):6392-7
No comments: Submit comment
No validations: Submit validation data