Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310708 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Kallikrein B, Plasma (Fletcher Factor) 1 (KLKB1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KLKB1 antibody: synthetic peptide directed towards the middle region of human KLKB1
- Description
- Protein A purified
- Reactivity
- Human, Porcine
- Host
- Rabbit
- Antigen sequence
VLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPF
SQIKE IIIHQNYKVS- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Expression, crystallization, and three-dimensional structure of the catalytic domain of human plasma kallikrein.
Tang J, Yu CL, Williams SR, Springman E, Jeffery D, Sprengeler PA, Estevez A, Sampang J, Shrader W, Spencer J, Young W, McGrath M, Katz BA
The Journal of biological chemistry 2005 Dec 9;280(49):41077-89
The Journal of biological chemistry 2005 Dec 9;280(49):41077-89
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting