HPA005634

KLKB1 antibody from Sigma-Aldrich
KLK3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005634
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005634, RRID:AB_1079214
Product name
Anti-KLKB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005634
Antibody type
Polyclonal
Antigen
Plasma kallikrein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNC
LFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQ
ENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEEL
NVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKE
EKCK
Storage
-20C
Provider Type Product Number
- No reagents -