HPA001885

SERPINF2 antibody from Atlas Antibodies
A2AP, AAP, ALPHA-2-PI, API, PLI
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001885
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001885, RRID:AB_1079922
Product name
Anti-SERPINF2
Provider product page
Atlas Antibodies - HPA001885
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VPVEMMQARTYPLRWFLLEQPEIQVAHFPFKNNMS
FVVLVPTHFEWNVSQVLANLSWDTLHPPLVWERPT
KVRLPKLYLKHQMDLVATLSQLGLQELFQAPDLRG
ISEQSLVVSGVQHQSTL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -