HPA001885

SERPINF2 antibody from Sigma-Aldrich
A2AP, AAP, ALPHA-2-PI, API, PLI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001885
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001885, RRID:AB_1079922
Product name
Anti-SERPINF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001885
Antibody type
Polyclonal
Antigen
alpha-2-Antiplasmin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VPVEMMQARTYPLRWFLLEQPEIQVAHFPFKNNMS
FVVLVPTHFEWNVSQVLANLSWDTLHPPLVWERPT
KVRLPKLYLKHQMDLVATLSQLGLQELFQAPDLRG
ISEQSLVVSGVQHQSTL
Storage
-20C
Provider Type Product Number
- No reagents -