Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502332 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ubiquitin-Conjugating Enzyme E2L 3 (UBE2L3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-UBE2L3 antibody: synthetic peptide directed towards the middle region of human UBE2L3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
WQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKIT
FKTKI YHPNIDEKGQ- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Involvement of c-myc-regulated genes in hepatocellular carcinoma related to genotype-C hepatitis B virus.
Iizuka N, Tsunedomi R, Tamesa T, Okada T, Sakamoto K, Hamaguchi T, Yamada-Okabe H, Miyamoto T, Uchimura S, Hamamoto Y, Oka M
Journal of cancer research and clinical oncology 2006 Jul;132(7):473-81
Journal of cancer research and clinical oncology 2006 Jul;132(7):473-81
No comments: Submit comment
No validations: Submit validation data