Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183871 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Aprataxin (APTX) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-APTX antibody: synthetic peptide directed towards the C terminal of human APTX
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
VIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLP
SIPQL KEHLRKHWTQ- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Aprataxin tumor levels predict response of colorectal cancer patients to irinotecan-based treatment.
XLF interacts with the XRCC4-DNA ligase IV complex to promote DNA nonhomologous end-joining.
Dopeso H, Mateo-Lozano S, Elez E, Landolfi S, Ramos Pascual FJ, Hernández-Losa J, Mazzolini R, Rodrigues P, Bazzocco S, Carreras MJ, Espín E, Armengol M, Wilson AJ, Mariadason JM, Ramon Y Cajal S, Tabernero J, Schwartz S Jr, Arango D
Clinical cancer research : an official journal of the American Association for Cancer Research 2010 Apr 15;16(8):2375-82
Clinical cancer research : an official journal of the American Association for Cancer Research 2010 Apr 15;16(8):2375-82
XLF interacts with the XRCC4-DNA ligase IV complex to promote DNA nonhomologous end-joining.
Ahnesorg P, Smith P, Jackson SP
Cell 2006 Jan 27;124(2):301-13
Cell 2006 Jan 27;124(2):301-13
No comments: Submit comment
No validations: Submit validation data