HPA016739

MAPRE2 antibody from Sigma-Aldrich
EB1, EB2, RP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016739
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016739, RRID:AB_1853570
Product name
Anti-MAPRE2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016739
Antibody type
Polyclonal
Antigen
Microtubule-associated protein RP/EB family member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFN
LPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAK
Storage
-20C
Provider Type Product Number
- No reagents -