Explore
Validate
Learn
Western blot
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001900 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001900, RRID:AB_1078865
- Product name
- Anti-FGB
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ERKAPDAGGCLHADPDLGVLCPTGCQLQEALLQQE
RPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLW
QKRQKQVKDNENVVNEYSSELEKHQLYIDETVNSN
IPTNLRVLRSILENLRSKIQKLE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Profiling post-centrifugation delay of serum and plasma with antibody bead arrays
Tumour expression of bladder cancer-associated urinary proteins
Classification of protein profiles from antibody microarrays using heat and detergent treatment
Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model.
Development of a fibrinogen-specific sandwich enzyme-linked immunosorbent assay microarray assay for distinguishing between blood plasma and serum samples.
Qundos U, Hong M, Tybring G, Divers M, Odeberg J, Uhlen M, Nilsson P, Schwenk J
Journal of Proteomics 2013 December;95
Journal of Proteomics 2013 December;95
Tumour expression of bladder cancer-associated urinary proteins
Lindén M, Segersten U, Runeson M, Wester K, Busch C, Pettersson U, Lind S, Malmström P
BJU International 2013 August;112(3):407-415
BJU International 2013 August;112(3):407-415
Classification of protein profiles from antibody microarrays using heat and detergent treatment
Häggmark A, Neiman M, Drobin K, Zwahlen M, Uhlén M, Nilsson P, Schwenk J
New Biotechnology 2012 June;29(5):564-570
New Biotechnology 2012 June;29(5):564-570
Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model.
Kato BS, Nicholson G, Neiman M, Rantalainen M, Holmes CC, Barrett A, Uhlén M, Nilsson P, Spector TD, Schwenk JM
Proteome science 2011 Nov 17;9:73
Proteome science 2011 Nov 17;9:73
Development of a fibrinogen-specific sandwich enzyme-linked immunosorbent assay microarray assay for distinguishing between blood plasma and serum samples.
Gonzalez RM, Zhang Q, Zangar RC, Smith RD, Metz TO
Analytical biochemistry 2011 Jul 1;414(1):99-102
Analytical biochemistry 2011 Jul 1;414(1):99-102
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-FGB antibody HPA001900 (A) shows similar pattern to independent antibody HPA001901 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line Hep G2 shows localization to endoplasmic reticulum.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex, liver, placenta and rectum using Anti-FGB antibody HPA001900 (A) shows similar protein distribution across tissues to independent antibody HPA001901 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong positivity in plasma in blood vessels.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong positivity in plasma in blood vessels, as well as positivity in extracellular matrix.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows weak to moderate cytoplasmic positivity in hepatocytes.
- Sample type
- HUMAN
