HPA001901

FGB antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001901
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001901, RRID:AB_1078864
Product name
Anti-FGB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001901
Antibody type
Polyclonal
Antigen
Fibrinogen beta-chain precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNY
CGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGD
KVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMD
GASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDP
RKQC
Storage
-20C
Provider Type Product Number
- No reagents -