H00000002-M03

A2M antibody from Abnova Corporation
CPAMD5, FWP007, S863-7

Antibody data

Product number
H00000002-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000002-M03, RRID:AB_1237631
Product name
A2M monoclonal antibody (M03), clone 2B5
Provider product page
Abnova Corporation - H00000002-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant A2M.
Antigen sequence
DCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGL
KAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYES
DVMGRGHARLVHVEEPHTET
Isotype
IgG
Antibody clone number
2B5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -