HPA002265

A2M antibody from Sigma-Aldrich
CPAMD5, FWP007, S863-7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002265
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002265, RRID:AB_1078142
Product name
Anti-A2M antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002265
Antibody type
Polyclonal
Antigen
alpha2-Macroglobulin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVLLMKPDAELSASSVYNLLPEKDLTGFPGPLNDQ
DDEDCINRHNVYINGITYTPVSSTNEKDMYSFLED
MGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGF
YESDVMGRGHARLVHVEEPHTETVRKYFPETWIWD
LVVVNS
Storage
-20C
Provider Type Product Number
- No reagents -