HPA003827

F13B antibody from Sigma-Aldrich
FXIIIB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003827
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003827, RRID:AB_1078794
Product name
Anti-F13B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003827
Antibody type
Polyclonal
Antigen
Coagulation factor XIII B chain precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FCLAGYTTESGRQEEQTTCTTEGWSPEPRCFKKCT
KPDLSNGYISDVKLLYKIQENMHYGCASGYKTTGG
KDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGN
YSTTQKTFKVKDKVQYECATGYYTAGGKKTEEV
Storage
-20C
Provider Type Product Number
- No reagents -