SAB2100738

F13B antibody from Sigma-Aldrich
FXIIIB
No application information provided.

Antibody data

Product number
SAB2100738
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2100738, RRID:AB_10605483
Product name
Anti-F13B antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2100738
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_001985.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGS
DLIQCYNFGWYPESP
Storage
-20C
Provider Type Product Number
- No reagents -