HPA013357

IGFBP3 antibody from Sigma-Aldrich
BP-53, IBP3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013357
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013357, RRID:AB_1851489
Product name
Anti-IGFBP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013357
Antibody type
Polyclonal
Antigen
Insulin-like growth factor-binding protein 3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPL
HSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSE
SKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIP
NC
Storage
-20C
Provider Type Product Number
- No reagents -