HPA021827

FHOD3 antibody from Atlas Antibodies
FHOS2, FLJ22297, FLJ22717, KIAA1695
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021827
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021827, RRID:AB_1848571
Product name
Anti-FHOD3
Provider product page
Atlas Antibodies - HPA021827
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GVDTELLVYAMTLVNKTLSGLPDQDTFYDVVDCLE
ELGIAAVSQRHLNKKGTDLDLVEQLNIYEVALRHE
DGDETTEPPPSGCRDRRRASVCSSGGGEHRGLDRR
RSRRHSVQSIKSTLSAPTSPCSQSAPSFKPNQV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -