HPA021827

FHOD3 antibody from Atlas Antibodies
FHOS2, FLJ22297, FLJ22717, KIAA1695

Antibody data

Product number
HPA021827
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021827, RRID:AB_1848571
Product name
Anti-FHOD3
Provider product page
Atlas Antibodies - HPA021827
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GVDTELLVYAMTLVNKTLSGLPDQDTFYDVVDCLE
ELGIAAVSQRHLNKKGTDLDLVEQLNIYEVALRHE
DGDETTEPPPSGCRDRRRASVCSSGGGEHRGLDRR
RSRRHSVQSIKSTLSAPTSPCSQSAPSFKPNQV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.