Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN630729 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Formin Homology 2 Domain Containing 3 (FHOD3) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- FHOD3 antibody was raised using the C terminal of FHOD3 corresponding to a region with amino acids SGKFSGSSPAPPSQPQGLSYAEDAAEHENMKAVLKTSSPSVEDATPALGV
- Description
- Affinity purified
- Reactivity
- Human
- Host
- Rabbit
- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1 mg/mL
- Storage
- Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
- Handling
- Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.
No comments: Submit comment
No validations: Submit validation data