Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001641 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001641, RRID:AB_1079795
- Product name
- Anti-RBP4
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEF
SVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDT
EDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYA
VQYSCRLLNLDGTCA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The new platinum-based anticancer agent LA-12 induces retinol binding protein 4 in vivo.
Retinol-binding protein 4 (RBP4) protein expression is increased in omental adipose tissue of severely obese patients.
Bouchal P, Jarkovsky J, Hrazdilova K, Dvorakova M, Struharova I, Hernychova L, Damborsky J, Sova P, Vojtesek B
Proteome science 2011 Oct 31;9(1):68
Proteome science 2011 Oct 31;9(1):68
Retinol-binding protein 4 (RBP4) protein expression is increased in omental adipose tissue of severely obese patients.
Kelly KR, Kashyap SR, O'Leary VB, Major J, Schauer PR, Kirwan JP
Obesity (Silver Spring, Md.) 2010 Apr;18(4):663-6
Obesity (Silver Spring, Md.) 2010 Apr;18(4):663-6
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows distinct cytoplasmic positivity in hepatocytes.
- Sample type
- HUMAN