HPA001616

KNG1 antibody from Sigma-Aldrich
BDK, BK, KNG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001616
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001616, RRID:AB_1079216
Product name
Anti-KNG1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001616
Antibody type
Polyclonal
Antigen
Kininogen-1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSF
KYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTA
TVGKRSSTKFSVATQTCQITPAEGPVVTAQYDCLG
CVHPISTQSPDLEPILRHGIQYFNNN
Storage
-20C
Provider Type Product Number
- No reagents -