HPA001617

MASP1 antibody from Atlas Antibodies
CRARF, MASP, PRSS5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001617
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001617, RRID:AB_1079314
Product name
Anti-MASP1
Provider product page
Atlas Antibodies - HPA001617
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSV
LILFHSDNSGENRGWRLSYRAAGNECPELQPPVHG
KIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTF
QIECLKDGTWSNKIPT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -