HPA001617

MASP1 antibody from Sigma-Aldrich
CRARF, MASP, PRSS5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001617
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001617, RRID:AB_1079314
Product name
Anti-MASP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001617
Antibody type
Polyclonal
Antigen
Complement-activating component of Ra-reactive factor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSV
LILFHSDNSGENRGWRLSYRAAGNECPELQPPVHG
KIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTF
QIECLKDGTWSNKIPT
Storage
-20C
Provider Type Product Number
- No reagents -