Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004488-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004488-M04, RRID:AB_565981
- Product name
- MSX2 monoclonal antibody (M04), clone 1F6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MSX2.
- Antigen sequence
TASVKSENSEDGAAWMQEPGRYSPPPRHMSPTTCT
LRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIA
ERAEFSSSLNLTETQVKIWFQNRRAKAKRL*- Isotype
- IgG
- Antibody clone number
- 1F6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Establishment of human dental epithelial cell lines expressing ameloblastin and enamelin by transfection of hTERT and cdk4 cDNAs.
Hatakeyama S, Mizusawa N, Tsutsumi R, Yoshimoto K, Mizuki H, Yasumoto S, Sato S, Takeda Y
Journal of oral pathology & medicine : official publication of the International Association of Oral Pathologists and the American Academy of Oral Pathology 2011 Mar;40(3):227-34
Journal of oral pathology & medicine : official publication of the International Association of Oral Pathologists and the American Academy of Oral Pathology 2011 Mar;40(3):227-34
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to MSX2 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to MSX2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol