HPA001867

CLOCK antibody from Sigma-Aldrich
bHLHe8, KAT13D, KIAA0334
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001867
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001867, RRID:AB_1078537
Product name
Anti-CLOCK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001867
Antibody type
Polyclonal
Antigen
Circadian locomoter output cycles protein kaput recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFG
SVQLSSGNSSNIQQLAPINMQGQVVPTNQIQSGMN
TGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQT
SLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSM
PQNSTQS
Storage
-20C
Provider Type Product Number
- No reagents -