H00010215-B01

OLIG2 antibody from Abnova Corporation
BHLHB1, bHLHe19, OLIGO2, PRKCBP2, RACK17

Antibody data

Product number
H00010215-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010215-B01, RRID:AB_1204747
Product name
OLIG2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00010215-B01
Antibody type
Polyclonal
Antigen
OLIG2 (AAH36245.1, 1 a.a. ~ 323 a.a) full-length human protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFT
GGTVSSSTPSDCPPELSAELRGAMGSAGAHPVDKL
GGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPE
LQQLRLKINSRERKRMHDLNIAMDGLREVMPYAHG
PSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSE
IYGGHHAGFHPSACGGLAHSAPLPAATAHPAAAAH
AAHHPAVHHPILPPAAAAAAAAAAAAAVSSASLPG
SGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSG
ASGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGSL
PRLTSDAK
Vial size
50 uL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -