HPA003259

MITF antibody from Sigma-Aldrich
bHLHe32, MI, WS2, WS2A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003259
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003259, RRID:AB_1079381
Product name
Anti-MITF antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003259
Antibody type
Polyclonal
Antigen
Microphthalmia-associated transcription factor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRI
IKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTIT
FNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLS
PVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHT
Storage
-20C
Provider Type Product Number
- No reagents -