Antibody data

Product number
H00004092-M09
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004092-M09, RRID:AB_607056
Product name
SMAD7 monoclonal antibody (M09), clone 1G10
Provider product page
Abnova Corporation - H00004092-M09
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SMAD7.
Antigen sequence
CKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCN
PHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAV
PSSAETGGTNYLAPGGLSDSQLLLEPGDRSH
Isotype
IgG
Antibody clone number
1G10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -