HPA020454

DNAJC2 antibody from Atlas Antibodies
MPHOSPH11, MPP11, ZRF1, ZUO1, zuotin
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020454
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020454, RRID:AB_1859492
Product name
Anti-DNAJC2
Provider product page
Atlas Antibodies - HPA020454
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EEINEQIRKEKEEAEARMRQASKNTEKSTGGGGNG
SKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMN
IHSSSGVKRTAKDV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -