H00027000-M09

DNAJC2 antibody from Abnova Corporation
MPHOSPH11, MPP11, ZRF1, ZUO1, zuotin

Antibody data

Product number
H00027000-M09
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027000-M09, RRID:AB_1237920
Product name
ZRF1 monoclonal antibody (M09), clone 3F2
Provider product page
Abnova Corporation - H00027000-M09
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZRF1.
Antigen sequence
LDPHQKDDINKKAFDKFKKEHGVVPQADNATPSER
FEGPYTDFTPWTTEEQKLLEQALKTYPVNTPERWE
KIAEAVPGRTKKDCMKRYKELVEMVKAKKAA
Isotype
IgG
Antibody clone number
3F2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -