HPA020454

DNAJC2 antibody from Sigma-Aldrich
MPHOSPH11, MPP11, ZRF1, ZUO1, zuotin
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020454
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020454, RRID:AB_1859492
Product name
Anti-DNAJC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020454
Antibody type
Polyclonal
Antigen
DnaJ homolog subfamily C member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEINEQIRKEKEEAEARMRQASKNTEKSTGGGGNG
SKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMN
IHSSSGVKRTAKDV
Storage
-20C
Provider Type Product Number
- No reagents -