HPA019182

TBL1XR1 antibody from Sigma-Aldrich
C21, DC42, FLJ12894, IRA1, TBLR1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019182
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019182, RRID:AB_1857800
Product name
Anti-TBL1XR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019182
Antibody type
Polyclonal
Antigen
F-box-like/WD repeat-containing protein TBL1XR1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RPIESLSLIDAVMPDVVQTRQQAYRDKLAQQQAAA
AAAAAAAASQQGSAKNGENTANGEENGAHTIANNH
TDMMEVDGDVEIPPNKAVVLRGHE
Storage
-20C
Provider Type Product Number
- No reagents -