Antibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA019665 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA019665, RRID:AB_2274278
- Product name
- Anti-ATG2B
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SQIQEPCCSDLFLFPDESGNVSQESGPTYASFSHH
FISDAMTGVPTENDDFCILFAPKAAMQEKEEEPVI
KIMVDDAIVIRDNYFSLPVNKTDTSKAPLHFPIPV
IRYVVKEVSLVWHLYGGKDFGTVPPTSPA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references
SMAC mimetics induce autophagy-dependent apoptosis of HIV-1-infected macrophages
ATG2 transports lipids to promote autophagosome biogenesis
SMAC Mimetics Induce Autophagy-Dependent Apoptosis of HIV-1-Infected Resting Memory CD4+ T Cells
Atg2A/B deficiency switches cytoprotective autophagy to non-canonical caspase-8 activation and apoptosis
A non-conserved miRNA regulates lysosomal function and impacts on a human lysosomal storage disorder
Korfhage J, Wan N, Elhan H, Kauffman L, Pineda M, Fuller D, Thiam A, Reinisch K, Melia T
2023
2023
SMAC mimetics induce autophagy-dependent apoptosis of HIV-1-infected macrophages
Campbell G, To R, Zhang G, Spector S
Cell Death & Disease 2020;11(7)
Cell Death & Disease 2020;11(7)
ATG2 transports lipids to promote autophagosome biogenesis
Valverde D, Yu S, Boggavarapu V, Kumar N, Lees J, Walz T, Reinisch K, Melia T
Journal of Cell Biology 2019;218(6):1787-1798
Journal of Cell Biology 2019;218(6):1787-1798
SMAC Mimetics Induce Autophagy-Dependent Apoptosis of HIV-1-Infected Resting Memory CD4+ T Cells
Campbell G, Bruckman R, Chu Y, Trout R, Spector S
Cell Host & Microbe 2018;24(5):689-702.e7
Cell Host & Microbe 2018;24(5):689-702.e7
Atg2A/B deficiency switches cytoprotective autophagy to non-canonical caspase-8 activation and apoptosis
Tang Z, Takahashi Y, Chen C, Liu Y, He H, Tsotakos N, Serfass J, Gebru M, Chen H, Young M, Wang H
Cell Death & Differentiation 2017;24(12):2127-2138
Cell Death & Differentiation 2017;24(12):2127-2138
A non-conserved miRNA regulates lysosomal function and impacts on a human lysosomal storage disorder
Frankel L, Di Malta C, Wen J, Eskelinen E, Ballabio A, Lund A
Nature Communications 2014;5(1)
Nature Communications 2014;5(1)
No comments: Submit comment
No validations: Submit validation data