HPA000880

ATG2B antibody from Sigma-Aldrich
C14orf103, FLJ10242
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000880
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000880, RRID:AB_1078888
Product name
Anti-ATG2B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000880
Antibody type
Polyclonal
Antigen
Autophagy-related protein 2 homolog B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SKEETGSHSPVCLQLHYKHSENRGPQGNQARLSSV
PHKAELQIKLNPVCCELDISIVDRLNSLLQPQKLA
TVEMMASHMYTSYNKHISLHKAFTEVFLDDSHSPA
NCRISVQVATPALNLSVRFPI
Storage
-20C
Provider Type Product Number
- No reagents -