HPA001765

MYOM2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001765
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001765, RRID:AB_1079443
Product name
Anti-MYOM2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001765
Antibody type
Polyclonal
Antigen
Myomesin-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
STQASSQKSLSQRSSSQRASSQTSLGGTICRVCAK
RVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSEL
AHLEEDVHLARSQARDKLDKYAIQQMMEDKLAWER
HTFEERISRAPEILVRLRSHTVWERMSVKLCFTVQ
GF
Storage
-20C
Provider Type Product Number
- No reagents -