HPA005922

FHL2 antibody from Sigma-Aldrich
DRAL, SLIM3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005922
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005922, RRID:AB_1078860
Product name
Anti-FHL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005922
Antibody type
Polyclonal
Antigen
Four and a half LIM domains protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCK
KPITTGGVTYREQPWHKECFVCTACRKQLSGQRFT
ARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKY
ISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDIL
CPDC
Storage
-20C
Provider Type Product Number
- No reagents -