HPA003432

ITGA8 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003432
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003432, RRID:AB_1851825
Product name
Anti-ITGA8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003432
Antibody type
Polyclonal
Antigen
Integrin alpha-8 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HKEEEVGPLVEHIYELHNIGPSTISDTILEVGWPF
SARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPA
ASPEDTPELSAFLRNSTIPHLVRKRDVHVVEFHRQ
SPAKILNCTNIECLQISCA
Storage
-20C
Provider Type Product Number
- No reagents -