Antibody data
- Product number
- HPA005980
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA005980, RRID:AB_1079278
- Product name
- Anti-LRP2
- Provider product page
- Atlas Antibodies - HPA005980
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GFTSMSDRPGKRCAAEGSSPLLLLPDNVRIRKYNL
SSERFSEYLQDEEYIQAVDYDWDPEDIGLSVVYYT
VRGEGSRFGAIKRAYIPNFESGRNNLVQEVDLKLK
YVMQPDGIAVDWVGRHIYWSDVKNKRIEVAKLDGR
YRKWLISTDL
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Angiotensin type 1 receptor modulates macrophage polarization and renal injury in obesity
Ma L, Corsa B, Zhou J, Yang H, Li H, Tang Y, Babaev V, Major A, Linton M, Fazio S, Hunley T, Kon V, Fogo A
AJP: Renal Physiology 2011 May;300(5)
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney shows high expression.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human lymph node shows low expression as expected.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human thyroid gland shows moderate to strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-LRP2 antibody. Corresponding LRP2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human kidney and skeletal muscle tissues using HPA005980 antibody. Corresponding LRP2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more